Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 606261..607060 | Replicon | chromosome |
Accession | NZ_OW967975 | ||
Organism | Escherichia coli isolate 10 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | LQ150_RS02950 | Protein ID | WP_000347275.1 |
Coordinates | 606261..606725 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | LQ150_RS02955 | Protein ID | WP_001307405.1 |
Coordinates | 606725..607060 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ150_RS02920 (601262) | 601262..601696 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
LQ150_RS02925 (601714) | 601714..602592 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LQ150_RS02930 (602582) | 602582..603361 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LQ150_RS02935 (603372) | 603372..603845 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LQ150_RS02940 (603868) | 603868..605148 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LQ150_RS02945 (605397) | 605397..606206 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
LQ150_RS02950 (606261) | 606261..606725 | - | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LQ150_RS02955 (606725) | 606725..607060 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LQ150_RS02960 (607209) | 607209..608780 | - | 1572 | WP_001273752.1 | galactarate dehydratase | - |
LQ150_RS02965 (609155) | 609155..610489 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
LQ150_RS02970 (610505) | 610505..611275 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 606261..617935 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T295901 WP_000347275.1 NZ_OW967975:c606725-606261 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |