Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 640900..641699 | Replicon | chromosome |
| Accession | NZ_LT906474 | ||
| Organism | Escherichia coli strain NCTC122 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | CKV98_RS03275 | Protein ID | WP_000347273.1 |
| Coordinates | 640900..641364 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | CKV98_RS03280 | Protein ID | WP_001307405.1 |
| Coordinates | 641364..641699 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV98_RS03240 | 635901..636335 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
| CKV98_RS03245 | 636353..637231 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| CKV98_RS03250 | 637221..638000 | - | 780 | WP_000406209.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| CKV98_RS03255 | 638011..638484 | - | 474 | WP_081508768.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| CKV98_RS03260 | 638507..639787 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| CKV98_RS03270 | 640036..640845 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| CKV98_RS03275 | 640900..641364 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| CKV98_RS03280 | 641364..641699 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| CKV98_RS03285 | 641848..643419 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| CKV98_RS03290 | 643794..645128 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| CKV98_RS03295 | 645144..645914 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 640900..652574 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T293743 WP_000347273.1 NZ_LT906474:c641364-640900 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |