Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3646210..3647009 | Replicon | chromosome |
Accession | NZ_LT601384 | ||
Organism | Escherichia coli isolate NCTC86EC |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | NCTC86EC_RS17955 | Protein ID | WP_000347275.1 |
Coordinates | 3646545..3647009 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NCTC86EC_RS17950 | Protein ID | WP_001307405.1 |
Coordinates | 3646210..3646545 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCTC86EC_RS17935 | 3641995..3642765 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NCTC86EC_RS17940 | 3642781..3644115 | - | 1335 | WP_066008923.1 | galactarate/glucarate/glycerate transporter GarP | - |
NCTC86EC_RS17945 | 3644490..3646061 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
NCTC86EC_RS17950 | 3646210..3646545 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NCTC86EC_RS17955 | 3646545..3647009 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NCTC86EC_RS17960 | 3647064..3647873 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NCTC86EC_RS17965 | 3648122..3649402 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NCTC86EC_RS17970 | 3649425..3649898 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NCTC86EC_RS17975 | 3649909..3650688 | + | 780 | WP_000406209.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
NCTC86EC_RS17980 | 3650678..3651556 | + | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
NCTC86EC_RS17985 | 3651574..3652008 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3637062..3647009 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T293279 WP_000347275.1 NZ_LT601384:3646545-3647009 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |