Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 673392..674191 | Replicon | chromosome |
Accession | NZ_LR890606 | ||
Organism | Escherichia coli isolate MINF_8D-sc-2280460 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | JMW69_RS03280 | Protein ID | WP_000347273.1 |
Coordinates | 673392..673856 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | JMW69_RS03285 | Protein ID | WP_001307405.1 |
Coordinates | 673856..674191 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW69_RS03250 | 668393..668827 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
JMW69_RS03255 | 668845..669723 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JMW69_RS03260 | 669713..670492 | - | 780 | WP_000406209.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JMW69_RS03265 | 670503..670976 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JMW69_RS03270 | 670999..672279 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JMW69_RS03275 | 672528..673337 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
JMW69_RS03280 | 673392..673856 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JMW69_RS03285 | 673856..674191 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JMW69_RS03290 | 674340..675911 | - | 1572 | WP_069905074.1 | galactarate dehydratase | - |
JMW69_RS03295 | 676286..677620 | + | 1335 | WP_069905075.1 | galactarate/glucarate/glycerate transporter GarP | - |
JMW69_RS03300 | 677636..678406 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 673392..685066 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T291545 WP_000347273.1 NZ_LR890606:c673856-673392 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |