Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3260493..3261292 | Replicon | chromosome |
| Accession | NZ_LR881938 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | IEU92_RS15810 | Protein ID | WP_000347273.1 |
| Coordinates | 3260828..3261292 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | IEU92_RS15805 | Protein ID | WP_001307405.1 |
| Coordinates | 3260493..3260828 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEU92_RS15790 | 3256278..3257048 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| IEU92_RS15795 | 3257064..3258398 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| IEU92_RS15800 | 3258773..3260344 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| IEU92_RS15805 | 3260493..3260828 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| IEU92_RS15810 | 3260828..3261292 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| IEU92_RS15815 | 3261347..3262156 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| IEU92_RS15820 | 3262405..3263685 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| IEU92_RS15825 | 3263708..3264181 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| IEU92_RS15830 | 3264192..3264563 | + | 372 | Protein_3088 | PTS sugar transporter subunit IIC | - |
| IEU92_RS15835 | 3264559..3265116 | + | 558 | Protein_3089 | amidohydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 3251345..3261292 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T289527 WP_000347273.1 NZ_LR881938:3260828-3261292 [Escherichia coli str. K-12 substr. MG1655]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12358.94 Da Isoelectric Point: 4.8616
>AT289527 WP_001307405.1 NZ_LR881938:3260493-3260828 [Escherichia coli str. K-12 substr. MG1655]
MPANARSHAVLTTESKVTIRGQTTIPAPVREALKLKPGQDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFNIQQGKKLVAGMDVNIDDEIGDDE
MPANARSHAVLTTESKVTIRGQTTIPAPVREALKLKPGQDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFNIQQGKKLVAGMDVNIDDEIGDDE
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |