Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 1870414..1871213 | Replicon | chromosome |
Accession | NZ_LR536430 | ||
Organism | Escherichia coli isolate f974b26a-5e81-11e8-bf7f-3c4a9275d6c8 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | D7XZ20 |
Locus tag | E4Z69_RS09545 | Protein ID | WP_000347264.1 |
Coordinates | 1870749..1871213 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | E4Z69_RS09540 | Protein ID | WP_001307405.1 |
Coordinates | 1870414..1870749 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4Z69_RS09525 | 1866199..1866969 | - | 771 | WP_001058207.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
E4Z69_RS09530 | 1866985..1868319 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
E4Z69_RS09535 | 1868694..1870265 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
E4Z69_RS09540 | 1870414..1870749 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
E4Z69_RS09545 | 1870749..1871213 | + | 465 | WP_000347264.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
E4Z69_RS09550 | 1871268..1872077 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
E4Z69_RS09555 | 1872326..1873606 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
E4Z69_RS09560 | 1873629..1874102 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
E4Z69_RS09565 | 1874113..1874892 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
E4Z69_RS09570 | 1874882..1875760 | + | 879 | WP_001300474.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
E4Z69_RS09575 | 1875778..1876212 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1861371..1871213 | 9842 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17894.29 Da Isoelectric Point: 9.4945
>T288392 WP_000347264.1 NZ_LR536430:1870749-1871213 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFDAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFDAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A241QML2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |