Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 606059..606858 | Replicon | chromosome |
| Accession | NZ_LR134295 | ||
| Organism | Escherichia coli strain NCTC9080 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | EL145_RS02930 | Protein ID | WP_000347273.1 |
| Coordinates | 606059..606523 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A0K5UM65 |
| Locus tag | EL145_RS02935 | Protein ID | WP_025670440.1 |
| Coordinates | 606523..606858 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL145_RS02900 | 601060..601494 | - | 435 | WP_000948814.1 | PTS sugar transporter subunit IIA | - |
| EL145_RS02905 | 601512..602390 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| EL145_RS02910 | 602380..603159 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| EL145_RS02915 | 603170..603643 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| EL145_RS02920 | 603666..604946 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| EL145_RS02925 | 605195..606004 | + | 810 | WP_126327469.1 | aga operon transcriptional regulator AgaR | - |
| EL145_RS02930 | 606059..606523 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| EL145_RS02935 | 606523..606858 | - | 336 | WP_025670440.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| EL145_RS02940 | 607007..608578 | - | 1572 | WP_032202412.1 | galactarate dehydratase | - |
| EL145_RS02945 | 608953..610287 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| EL145_RS02950 | 610303..611073 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 606059..617733 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T287466 WP_000347273.1 NZ_LR134295:c606523-606059 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K5UM65 |