Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2896497..2897296 | Replicon | chromosome |
Accession | NZ_CP128218 | ||
Organism | Escherichia coli strain TG1 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | QSI84_RS14230 | Protein ID | WP_000347273.1 |
Coordinates | 2896832..2897296 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QSI84_RS14225 | Protein ID | WP_001307405.1 |
Coordinates | 2896497..2896832 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSI84_RS14210 (2892282) | 2892282..2893052 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
QSI84_RS14215 (2893068) | 2893068..2894402 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QSI84_RS14220 (2894777) | 2894777..2896348 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
QSI84_RS14225 (2896497) | 2896497..2896832 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QSI84_RS14230 (2896832) | 2896832..2897296 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QSI84_RS14235 (2897351) | 2897351..2898160 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QSI84_RS14240 (2898409) | 2898409..2899689 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QSI84_RS14245 (2899712) | 2899712..2900185 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QSI84_RS14250 (2900196) | 2900196..2900567 | + | 372 | Protein_2781 | PTS sugar transporter subunit IIC | - |
QSI84_RS14255 (2900563) | 2900563..2901120 | + | 558 | Protein_2782 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2887349..2897296 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T284430 WP_000347273.1 NZ_CP128218:2896832-2897296 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |