Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 623036..623835 | Replicon | chromosome |
Accession | NZ_CP126343 | ||
Organism | Escherichia coli strain DAX4 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | QN220_RS03045 | Protein ID | WP_153443454.1 |
Coordinates | 623036..623500 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QN220_RS03050 | Protein ID | WP_001307405.1 |
Coordinates | 623500..623835 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN220_RS03015 (618037) | 618037..618471 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QN220_RS03020 (618489) | 618489..619367 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QN220_RS03025 (619357) | 619357..620136 | - | 780 | WP_284562154.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QN220_RS03030 (620147) | 620147..620620 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QN220_RS03035 (620643) | 620643..621923 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QN220_RS03040 (622172) | 622172..622981 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QN220_RS03045 (623036) | 623036..623500 | - | 465 | WP_153443454.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QN220_RS03050 (623500) | 623500..623835 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QN220_RS03055 (623984) | 623984..625555 | - | 1572 | WP_153443453.1 | galactarate dehydratase | - |
QN220_RS03060 (625930) | 625930..627264 | + | 1335 | WP_284562155.1 | galactarate/glucarate/glycerate transporter GarP | - |
QN220_RS03065 (627280) | 627280..628050 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 623036..634710 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.23 Da Isoelectric Point: 9.8489
>T282847 WP_153443454.1 NZ_CP126343:c623500-623036 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADRETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADRETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|