Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 608532..609331 | Replicon | chromosome |
Accession | NZ_CP122880 | ||
Organism | Escherichia coli strain ETEC1716 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | QDX09_RS02995 | Protein ID | WP_000347273.1 |
Coordinates | 608532..608996 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QDX09_RS03000 | Protein ID | WP_001307405.1 |
Coordinates | 608996..609331 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX09_RS02965 (603533) | 603533..603967 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QDX09_RS02970 (603985) | 603985..604863 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QDX09_RS02975 (604853) | 604853..605632 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QDX09_RS02980 (605643) | 605643..606116 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QDX09_RS02985 (606139) | 606139..607419 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QDX09_RS02990 (607668) | 607668..608477 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QDX09_RS02995 (608532) | 608532..608996 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QDX09_RS03000 (608996) | 608996..609331 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QDX09_RS03005 (609480) | 609480..611051 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
QDX09_RS03010 (611426) | 611426..612760 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QDX09_RS03015 (612776) | 612776..613546 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 608532..620205 | 11673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T278174 WP_000347273.1 NZ_CP122880:c608996-608532 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |