Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 623561..624360 | Replicon | chromosome |
| Accession | NZ_CP122499 | ||
| Organism | Escherichia coli strain W409 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | QC809_RS03085 | Protein ID | WP_000347273.1 |
| Coordinates | 623561..624025 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QC809_RS03090 | Protein ID | WP_001307405.1 |
| Coordinates | 624025..624360 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC809_RS03055 (618562) | 618562..618996 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QC809_RS03060 (619014) | 619014..619892 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QC809_RS03065 (619882) | 619882..620661 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QC809_RS03070 (620672) | 620672..621145 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QC809_RS03075 (621168) | 621168..622448 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QC809_RS03080 (622697) | 622697..623506 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QC809_RS03085 (623561) | 623561..624025 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QC809_RS03090 (624025) | 624025..624360 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QC809_RS03095 (624509) | 624509..626080 | - | 1572 | WP_063084662.1 | galactarate dehydratase | - |
| QC809_RS03100 (626455) | 626455..627789 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QC809_RS03105 (627805) | 627805..628575 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 623561..636018 | 12457 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T277044 WP_000347273.1 NZ_CP122499:c624025-623561 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |