Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 1079938..1080737 | Replicon | chromosome |
Accession | NZ_CP122319 | ||
Organism | Escherichia coli strain BW25113 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | QCG47_RS05125 | Protein ID | WP_000347273.1 |
Coordinates | 1080273..1080737 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QCG47_RS05120 | Protein ID | WP_001307405.1 |
Coordinates | 1079938..1080273 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG47_RS05105 (1075723) | 1075723..1076493 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
QCG47_RS05110 (1076509) | 1076509..1077843 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QCG47_RS05115 (1078218) | 1078218..1079789 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
QCG47_RS05120 (1079938) | 1079938..1080273 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QCG47_RS05125 (1080273) | 1080273..1080737 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QCG47_RS05130 (1080792) | 1080792..1081601 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QCG47_RS05135 (1081850) | 1081850..1083130 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QCG47_RS05140 (1083153) | 1083153..1083626 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QCG47_RS05145 (1083637) | 1083637..1084008 | + | 372 | Protein_1001 | PTS sugar transporter subunit IIC | - |
QCG47_RS05150 (1084004) | 1084004..1084561 | + | 558 | Protein_1002 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1070790..1080737 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T276753 WP_000347273.1 NZ_CP122319:1080273-1080737 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |