Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4267408..4268207 | Replicon | chromosome |
Accession | NZ_CP122318 | ||
Organism | Escherichia coli strain HT873X1 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | QCG45_RS20935 | Protein ID | WP_000347273.1 |
Coordinates | 4267408..4267872 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QCG45_RS20940 | Protein ID | WP_001307405.1 |
Coordinates | 4267872..4268207 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG45_RS20910 (4263584) | 4263584..4264141 | - | 558 | Protein_4067 | amidohydrolase family protein | - |
QCG45_RS20915 (4264137) | 4264137..4264508 | - | 372 | Protein_4068 | PTS sugar transporter subunit IIC | - |
QCG45_RS20920 (4264519) | 4264519..4264992 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QCG45_RS20925 (4265015) | 4265015..4266295 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QCG45_RS20930 (4266544) | 4266544..4267353 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QCG45_RS20935 (4267408) | 4267408..4267872 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QCG45_RS20940 (4267872) | 4267872..4268207 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QCG45_RS20945 (4268356) | 4268356..4269927 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
QCG45_RS20950 (4270302) | 4270302..4271636 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QCG45_RS20955 (4271652) | 4271652..4272422 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4267408..4279082 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T276743 WP_000347273.1 NZ_CP122318:c4267872-4267408 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |