Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 1782496..1783295 | Replicon | chromosome |
Accession | NZ_CP122317 | ||
Organism | Escherichia coli strain HT-948 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | QCG49_RS08640 | Protein ID | WP_000347273.1 |
Coordinates | 1782831..1783295 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QCG49_RS08635 | Protein ID | WP_001307405.1 |
Coordinates | 1782496..1782831 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG49_RS08620 (1778281) | 1778281..1779051 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
QCG49_RS08625 (1779067) | 1779067..1780401 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QCG49_RS08630 (1780776) | 1780776..1782347 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
QCG49_RS08635 (1782496) | 1782496..1782831 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QCG49_RS08640 (1782831) | 1782831..1783295 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QCG49_RS08645 (1783350) | 1783350..1784159 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QCG49_RS08650 (1784408) | 1784408..1785688 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QCG49_RS08655 (1785711) | 1785711..1786184 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QCG49_RS08660 (1786195) | 1786195..1786566 | + | 372 | Protein_1693 | PTS sugar transporter subunit IIC | - |
QCG49_RS08665 (1786562) | 1786562..1787119 | + | 558 | Protein_1694 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1773348..1783295 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T276701 WP_000347273.1 NZ_CP122317:1782831-1783295 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |