Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 953782..954581 | Replicon | chromosome |
Accession | NZ_CP117971 | ||
Organism | Escherichia coli strain B-1109 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | PT723_RS04600 | Protein ID | WP_000347273.1 |
Coordinates | 953782..954246 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PT723_RS04605 | Protein ID | WP_001307405.1 |
Coordinates | 954246..954581 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT723_RS04570 (948783) | 948783..949217 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
PT723_RS04575 (949235) | 949235..950113 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PT723_RS04580 (950103) | 950103..950882 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PT723_RS04585 (950893) | 950893..951366 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PT723_RS04590 (951389) | 951389..952669 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PT723_RS04595 (952918) | 952918..953727 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PT723_RS04600 (953782) | 953782..954246 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PT723_RS04605 (954246) | 954246..954581 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PT723_RS04610 (954730) | 954730..956301 | - | 1572 | WP_137044537.1 | galactarate dehydratase | - |
PT723_RS04615 (956676) | 956676..958010 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PT723_RS04620 (958026) | 958026..958796 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 953782..965456 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T272590 WP_000347273.1 NZ_CP117971:c954246-953782 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |