Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2880416..2881215 | Replicon | chromosome |
Accession | NZ_CP117962 | ||
Organism | Escherichia coli strain JM109 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | PT299_RS15195 | Protein ID | WP_000347273.1 |
Coordinates | 2880416..2880880 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PT299_RS15200 | Protein ID | WP_001307405.1 |
Coordinates | 2880880..2881215 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT299_RS15170 (2876592) | 2876592..2877149 | - | 558 | Protein_2712 | amidohydrolase family protein | - |
PT299_RS15175 (2877145) | 2877145..2877516 | - | 372 | Protein_2713 | PTS sugar transporter subunit IIC | - |
PT299_RS15180 (2877527) | 2877527..2878000 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PT299_RS15185 (2878023) | 2878023..2879303 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PT299_RS15190 (2879552) | 2879552..2880361 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PT299_RS15195 (2880416) | 2880416..2880880 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PT299_RS15200 (2880880) | 2880880..2881215 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PT299_RS15205 (2881364) | 2881364..2882935 | - | 1572 | WP_001273747.1 | galactarate dehydratase | - |
PT299_RS15210 (2883310) | 2883310..2884644 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PT299_RS15215 (2884660) | 2884660..2885430 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2880416..2892090 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T272551 WP_000347273.1 NZ_CP117962:c2880880-2880416 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |