Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3247218..3248017 | Replicon | chromosome |
Accession | NZ_CP117959 | ||
Organism | Escherichia coli strain B-2207 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | PT284_RS16550 | Protein ID | WP_000347275.1 |
Coordinates | 3247553..3248017 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PT284_RS16545 | Protein ID | WP_001307405.1 |
Coordinates | 3247218..3247553 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT284_RS16530 (3243003) | 3243003..3243773 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
PT284_RS16535 (3243789) | 3243789..3245123 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PT284_RS16540 (3245498) | 3245498..3247069 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
PT284_RS16545 (3247218) | 3247218..3247553 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PT284_RS16550 (3247553) | 3247553..3248017 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PT284_RS16555 (3248072) | 3248072..3248881 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PT284_RS16560 (3249130) | 3249130..3250410 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PT284_RS16565 (3250433) | 3250433..3250906 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PT284_RS16570 (3250917) | 3250917..3251696 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PT284_RS16575 (3251686) | 3251686..3252564 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PT284_RS16580 (3252582) | 3252582..3253016 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3238070..3248017 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T272508 WP_000347275.1 NZ_CP117959:3247553-3248017 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |