Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2420623..2421422 | Replicon | chromosome |
Accession | NZ_CP117001 | ||
Organism | Escherichia coli strain MLI108K2 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | NL410_RS13735 | Protein ID | WP_000347275.1 |
Coordinates | 2420958..2421422 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NL410_RS13730 | Protein ID | WP_001307405.1 |
Coordinates | 2420623..2420958 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL410_RS13715 (2416408) | 2416408..2417178 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NL410_RS13720 (2417194) | 2417194..2418528 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NL410_RS13725 (2418903) | 2418903..2420474 | + | 1572 | WP_001273752.1 | galactarate dehydratase | - |
NL410_RS13730 (2420623) | 2420623..2420958 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NL410_RS13735 (2420958) | 2420958..2421422 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NL410_RS13740 (2421477) | 2421477..2422286 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NL410_RS13745 (2422535) | 2422535..2423815 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NL410_RS13750 (2423838) | 2423838..2424311 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NL410_RS13755 (2424322) | 2424322..2425101 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NL410_RS13760 (2425091) | 2425091..2425969 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NL410_RS13765 (2425987) | 2425987..2426421 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2411475..2421422 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T269720 WP_000347275.1 NZ_CP117001:2420958-2421422 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |