Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2419867..2420666 | Replicon | chromosome |
Accession | NZ_CP116994 | ||
Organism | Escherichia coli strain MLI108K1 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | NL409_RS13720 | Protein ID | WP_000347275.1 |
Coordinates | 2420202..2420666 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NL409_RS13715 | Protein ID | WP_001307405.1 |
Coordinates | 2419867..2420202 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL409_RS13700 (2415652) | 2415652..2416422 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NL409_RS13705 (2416438) | 2416438..2417772 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NL409_RS13710 (2418147) | 2418147..2419718 | + | 1572 | WP_001273752.1 | galactarate dehydratase | - |
NL409_RS13715 (2419867) | 2419867..2420202 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NL409_RS13720 (2420202) | 2420202..2420666 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NL409_RS13725 (2420721) | 2420721..2421530 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NL409_RS13730 (2421779) | 2421779..2423059 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NL409_RS13735 (2423082) | 2423082..2423555 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NL409_RS13740 (2423566) | 2423566..2424345 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NL409_RS13745 (2424335) | 2424335..2425213 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NL409_RS13750 (2425231) | 2425231..2425665 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2410719..2420666 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T269689 WP_000347275.1 NZ_CP116994:2420202-2420666 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |