Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4077371..4078170 | Replicon | chromosome |
Accession | NZ_CP116191 | ||
Organism | Escherichia coli strain DETEC-E1070 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | PIC72_RS19880 | Protein ID | WP_000347275.1 |
Coordinates | 4077706..4078170 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PIC72_RS19875 | Protein ID | WP_001307405.1 |
Coordinates | 4077371..4077706 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC72_RS19860 (4073156) | 4073156..4073926 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
PIC72_RS19865 (4073942) | 4073942..4075276 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PIC72_RS19870 (4075651) | 4075651..4077222 | + | 1572 | WP_001273752.1 | galactarate dehydratase | - |
PIC72_RS19875 (4077371) | 4077371..4077706 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PIC72_RS19880 (4077706) | 4077706..4078170 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PIC72_RS19885 (4078225) | 4078225..4079034 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PIC72_RS19890 (4079283) | 4079283..4080563 | + | 1281 | WP_000681933.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PIC72_RS19895 (4080586) | 4080586..4081059 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PIC72_RS19900 (4081070) | 4081070..4081849 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PIC72_RS19905 (4081839) | 4081839..4082717 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PIC72_RS19910 (4082735) | 4082735..4083169 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4068223..4078170 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T268381 WP_000347275.1 NZ_CP116191:4077706-4078170 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |