Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4144960..4145759 | Replicon | chromosome |
| Accession | NZ_CP116115 | ||
| Organism | Escherichia coli strain DETEC-P793 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
| Locus tag | PIC92_RS20310 | Protein ID | WP_000347275.1 |
| Coordinates | 4145295..4145759 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | PIC92_RS20305 | Protein ID | WP_001307405.1 |
| Coordinates | 4144960..4145295 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC92_RS20290 (4140745) | 4140745..4141515 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| PIC92_RS20295 (4141531) | 4141531..4142865 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PIC92_RS20300 (4143240) | 4143240..4144811 | + | 1572 | WP_001273752.1 | galactarate dehydratase | - |
| PIC92_RS20305 (4144960) | 4144960..4145295 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PIC92_RS20310 (4145295) | 4145295..4145759 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PIC92_RS20315 (4145814) | 4145814..4146623 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| PIC92_RS20320 (4146872) | 4146872..4148152 | + | 1281 | WP_000681933.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PIC92_RS20325 (4148175) | 4148175..4148648 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PIC92_RS20330 (4148659) | 4148659..4149438 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PIC92_RS20335 (4149428) | 4149428..4150306 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PIC92_RS20340 (4150324) | 4150324..4150758 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 4135812..4145759 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T268074 WP_000347275.1 NZ_CP116115:4145295-4145759 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A6SPA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |