Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4078560..4079359 | Replicon | chromosome |
Accession | NZ_CP116103 | ||
Organism | Escherichia coli strain DETEC-P836 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | PIB67_RS19870 | Protein ID | WP_000347275.1 |
Coordinates | 4078895..4079359 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PIB67_RS19865 | Protein ID | WP_001307405.1 |
Coordinates | 4078560..4078895 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB67_RS19850 (4074345) | 4074345..4075115 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
PIB67_RS19855 (4075131) | 4075131..4076465 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PIB67_RS19860 (4076840) | 4076840..4078411 | + | 1572 | WP_001273752.1 | galactarate dehydratase | - |
PIB67_RS19865 (4078560) | 4078560..4078895 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PIB67_RS19870 (4078895) | 4078895..4079359 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PIB67_RS19875 (4079414) | 4079414..4080223 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PIB67_RS19880 (4080472) | 4080472..4081752 | + | 1281 | WP_000681933.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PIB67_RS19885 (4081775) | 4081775..4082248 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PIB67_RS19890 (4082259) | 4082259..4083038 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PIB67_RS19895 (4083028) | 4083028..4083906 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PIB67_RS19900 (4083924) | 4083924..4084358 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4069412..4079359 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T267979 WP_000347275.1 NZ_CP116103:4078895-4079359 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |