Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2739396..2740195 | Replicon | chromosome |
Accession | NZ_CP114896 | ||
Organism | Escherichia coli strain CM93 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | O6117_RS13440 | Protein ID | WP_000347273.1 |
Coordinates | 2739731..2740195 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | O6117_RS13435 | Protein ID | WP_001307405.1 |
Coordinates | 2739396..2739731 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6117_RS13420 (2735181) | 2735181..2735951 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
O6117_RS13425 (2735967) | 2735967..2737301 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
O6117_RS13430 (2737676) | 2737676..2739247 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
O6117_RS13435 (2739396) | 2739396..2739731 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
O6117_RS13440 (2739731) | 2739731..2740195 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
O6117_RS13445 (2740250) | 2740250..2741059 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
O6117_RS13450 (2741308) | 2741308..2742588 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
O6117_RS13455 (2742611) | 2742611..2743084 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
O6117_RS13460 (2743095) | 2743095..2743466 | + | 372 | Protein_2625 | PTS sugar transporter subunit IIC | - |
O6117_RS13465 (2743462) | 2743462..2744019 | + | 558 | Protein_2626 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2730248..2740195 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T267034 WP_000347273.1 NZ_CP114896:2739731-2740195 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |