Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3929278..3930077 | Replicon | chromosome |
Accession | NZ_CP114895 | ||
Organism | Escherichia coli strain CM56 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | O6106_RS19290 | Protein ID | WP_000347273.1 |
Coordinates | 3929613..3930077 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | O6106_RS19285 | Protein ID | WP_001307405.1 |
Coordinates | 3929278..3929613 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6106_RS19270 (3925063) | 3925063..3925833 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
O6106_RS19275 (3925849) | 3925849..3927183 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
O6106_RS19280 (3927558) | 3927558..3929129 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
O6106_RS19285 (3929278) | 3929278..3929613 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
O6106_RS19290 (3929613) | 3929613..3930077 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
O6106_RS19295 (3930132) | 3930132..3930941 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
O6106_RS19300 (3931190) | 3931190..3932470 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
O6106_RS19305 (3932493) | 3932493..3932966 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
O6106_RS19310 (3932977) | 3932977..3933348 | + | 372 | Protein_3750 | PTS sugar transporter subunit IIC | - |
O6106_RS19315 (3933344) | 3933344..3933901 | + | 558 | Protein_3751 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3920130..3930077 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T267015 WP_000347273.1 NZ_CP114895:3929613-3930077 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |