Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2639944..2640743 | Replicon | chromosome |
Accession | NZ_CP114894 | ||
Organism | Escherichia coli strain CM19 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | O6X69_RS12985 | Protein ID | WP_000347273.1 |
Coordinates | 2640279..2640743 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | O6X69_RS12980 | Protein ID | WP_001307405.1 |
Coordinates | 2639944..2640279 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6X69_RS12965 (2635729) | 2635729..2636499 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
O6X69_RS12970 (2636515) | 2636515..2637849 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
O6X69_RS12975 (2638224) | 2638224..2639795 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
O6X69_RS12980 (2639944) | 2639944..2640279 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
O6X69_RS12985 (2640279) | 2640279..2640743 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
O6X69_RS12990 (2640798) | 2640798..2641607 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
O6X69_RS12995 (2641856) | 2641856..2643136 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
O6X69_RS13000 (2643159) | 2643159..2643632 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
O6X69_RS13005 (2643643) | 2643643..2644014 | + | 372 | Protein_2534 | PTS sugar transporter subunit IIC | - |
O6X69_RS13010 (2644010) | 2644010..2644567 | + | 558 | Protein_2535 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2630796..2640743 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T266982 WP_000347273.1 NZ_CP114894:2640279-2640743 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |