Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 1827057..1827856 | Replicon | chromosome |
| Accession | NZ_CP114893 | ||
| Organism | Escherichia coli strain CM13 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | O6R07_RS08935 | Protein ID | WP_000347273.1 |
| Coordinates | 1827057..1827521 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | O6R07_RS08940 | Protein ID | WP_001307405.1 |
| Coordinates | 1827521..1827856 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6R07_RS08910 (1823233) | 1823233..1823790 | - | 558 | Protein_1725 | amidohydrolase family protein | - |
| O6R07_RS08915 (1823786) | 1823786..1824157 | - | 372 | Protein_1726 | PTS sugar transporter subunit IIC | - |
| O6R07_RS08920 (1824168) | 1824168..1824641 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| O6R07_RS08925 (1824664) | 1824664..1825944 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| O6R07_RS08930 (1826193) | 1826193..1827002 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| O6R07_RS08935 (1827057) | 1827057..1827521 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| O6R07_RS08940 (1827521) | 1827521..1827856 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| O6R07_RS08945 (1828005) | 1828005..1829576 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| O6R07_RS08950 (1829951) | 1829951..1831285 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| O6R07_RS08955 (1831301) | 1831301..1832071 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 1827057..1838731 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T266948 WP_000347273.1 NZ_CP114893:c1827521-1827057 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |