Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2506990..2507789 | Replicon | chromosome |
Accession | NZ_CP114892 | ||
Organism | Escherichia coli strain CM5 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | O6Q95_RS12330 | Protein ID | WP_000347273.1 |
Coordinates | 2507325..2507789 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | O6Q95_RS12325 | Protein ID | WP_001307405.1 |
Coordinates | 2506990..2507325 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q95_RS12310 (2502775) | 2502775..2503545 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
O6Q95_RS12315 (2503561) | 2503561..2504895 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
O6Q95_RS12320 (2505270) | 2505270..2506841 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
O6Q95_RS12325 (2506990) | 2506990..2507325 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
O6Q95_RS12330 (2507325) | 2507325..2507789 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
O6Q95_RS12335 (2507844) | 2507844..2508653 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
O6Q95_RS12340 (2508902) | 2508902..2510182 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
O6Q95_RS12345 (2510205) | 2510205..2510678 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
O6Q95_RS12350 (2510689) | 2510689..2511060 | + | 372 | Protein_2418 | PTS sugar transporter subunit IIC | - |
O6Q95_RS12355 (2511056) | 2511056..2511613 | + | 558 | Protein_2419 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2497842..2507789 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T266933 WP_000347273.1 NZ_CP114892:2507325-2507789 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |