Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 79257..80056 | Replicon | chromosome |
Accession | NZ_CP114891 | ||
Organism | Escherichia coli strain CM2 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | O6Q44_RS00425 | Protein ID | WP_000347273.1 |
Coordinates | 79257..79721 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | O6Q44_RS00430 | Protein ID | WP_001307405.1 |
Coordinates | 79721..80056 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q44_RS00400 (75433) | 75433..75990 | - | 558 | Protein_77 | amidohydrolase family protein | - |
O6Q44_RS00405 (75986) | 75986..76357 | - | 372 | Protein_78 | PTS sugar transporter subunit IIC | - |
O6Q44_RS00410 (76368) | 76368..76841 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
O6Q44_RS00415 (76864) | 76864..78144 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
O6Q44_RS00420 (78393) | 78393..79202 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
O6Q44_RS00425 (79257) | 79257..79721 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
O6Q44_RS00430 (79721) | 79721..80056 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
O6Q44_RS00435 (80205) | 80205..81776 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
O6Q44_RS00440 (82151) | 82151..83485 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
O6Q44_RS00445 (83501) | 83501..84271 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 79257..90931 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T266892 WP_000347273.1 NZ_CP114891:c79721-79257 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |