Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 462939..463738 | Replicon | chromosome |
Accession | NZ_CP110999 | ||
Organism | Escherichia coli strain J53-p133 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | ORI88_RS02330 | Protein ID | WP_000347273.1 |
Coordinates | 462939..463403 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | ORI88_RS02335 | Protein ID | WP_001307405.1 |
Coordinates | 463403..463738 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI88_RS02305 (459115) | 459115..459672 | - | 558 | Protein_450 | amidohydrolase family protein | - |
ORI88_RS02310 (459668) | 459668..460039 | - | 372 | Protein_451 | PTS sugar transporter subunit IIC | - |
ORI88_RS02315 (460050) | 460050..460523 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
ORI88_RS02320 (460546) | 460546..461826 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
ORI88_RS02325 (462075) | 462075..462884 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
ORI88_RS02330 (462939) | 462939..463403 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
ORI88_RS02335 (463403) | 463403..463738 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
ORI88_RS02340 (463887) | 463887..465458 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
ORI88_RS02345 (465833) | 465833..467167 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
ORI88_RS02350 (467183) | 467183..467953 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 462939..474613 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T264714 WP_000347273.1 NZ_CP110999:c463403-462939 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |