Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2026502..2027301 | Replicon | chromosome |
Accession | NZ_CP110996 | ||
Organism | Escherichia coli strain XYEH3783 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | ORI30_RS09735 | Protein ID | WP_000347275.1 |
Coordinates | 2026837..2027301 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | ORI30_RS09730 | Protein ID | WP_001307405.1 |
Coordinates | 2026502..2026837 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI30_RS09715 (2022287) | 2022287..2023057 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
ORI30_RS09720 (2023073) | 2023073..2024407 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
ORI30_RS09725 (2024782) | 2024782..2026353 | + | 1572 | WP_001273752.1 | galactarate dehydratase | - |
ORI30_RS09730 (2026502) | 2026502..2026837 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
ORI30_RS09735 (2026837) | 2026837..2027301 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
ORI30_RS09740 (2027356) | 2027356..2028165 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
ORI30_RS09745 (2028414) | 2028414..2029694 | + | 1281 | WP_000681933.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
ORI30_RS09750 (2029717) | 2029717..2030190 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
ORI30_RS09755 (2030201) | 2030201..2030980 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
ORI30_RS09760 (2030970) | 2030970..2031848 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
ORI30_RS09765 (2031866) | 2031866..2032300 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2017354..2027301 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T264695 WP_000347275.1 NZ_CP110996:2026837-2027301 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |