Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 607968..608767 | Replicon | chromosome |
Accession | NZ_CP110816 | ||
Organism | Escherichia coli strain THB42-F5 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | N0566_RS02960 | Protein ID | WP_000347273.1 |
Coordinates | 607968..608432 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N0566_RS02965 | Protein ID | WP_001307405.1 |
Coordinates | 608432..608767 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0566_RS02935 (604144) | 604144..604701 | - | 558 | Protein_574 | amidohydrolase family protein | - |
N0566_RS02940 (604697) | 604697..605068 | - | 372 | Protein_575 | PTS sugar transporter subunit IIC | - |
N0566_RS02945 (605079) | 605079..605552 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N0566_RS02950 (605575) | 605575..606855 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N0566_RS02955 (607104) | 607104..607913 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N0566_RS02960 (607968) | 607968..608432 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N0566_RS02965 (608432) | 608432..608767 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N0566_RS02970 (608916) | 608916..610487 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
N0566_RS02975 (610862) | 610862..612196 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
N0566_RS02980 (612212) | 612212..612982 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 607968..619642 | 11674 | ||
- | inside | Genomic island | - | - | 596984..619642 | 22658 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T264325 WP_000347273.1 NZ_CP110816:c608432-607968 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |