Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 608079..608878 | Replicon | chromosome |
| Accession | NZ_CP110814 | ||
| Organism | Escherichia coli strain THB42-F4 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | N0552_RS02960 | Protein ID | WP_000347273.1 |
| Coordinates | 608079..608543 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | N0552_RS02965 | Protein ID | WP_001307405.1 |
| Coordinates | 608543..608878 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0552_RS02935 (604255) | 604255..604812 | - | 558 | Protein_574 | amidohydrolase family protein | - |
| N0552_RS02940 (604808) | 604808..605179 | - | 372 | Protein_575 | PTS sugar transporter subunit IIC | - |
| N0552_RS02945 (605190) | 605190..605663 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N0552_RS02950 (605686) | 605686..606966 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N0552_RS02955 (607215) | 607215..608024 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N0552_RS02960 (608079) | 608079..608543 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N0552_RS02965 (608543) | 608543..608878 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N0552_RS02970 (609027) | 609027..610598 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| N0552_RS02975 (610973) | 610973..612307 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N0552_RS02980 (612323) | 612323..613093 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 608079..619753 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T264293 WP_000347273.1 NZ_CP110814:c608543-608079 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |