Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3374114..3374913 | Replicon | chromosome |
Accession | NZ_CP110017 | ||
Organism | Escherichia coli strain HE_50 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | OLR76_RS16615 | Protein ID | WP_000347273.1 |
Coordinates | 3374449..3374913 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | OLR76_RS16610 | Protein ID | WP_001307405.1 |
Coordinates | 3374114..3374449 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR76_RS16595 (3369899) | 3369899..3370669 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
OLR76_RS16600 (3370685) | 3370685..3372019 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
OLR76_RS16605 (3372394) | 3372394..3373965 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
OLR76_RS16610 (3374114) | 3374114..3374449 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
OLR76_RS16615 (3374449) | 3374449..3374913 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
OLR76_RS16620 (3374968) | 3374968..3375777 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
OLR76_RS16625 (3376026) | 3376026..3377306 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
OLR76_RS16630 (3377329) | 3377329..3377802 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
OLR76_RS16635 (3377813) | 3377813..3378184 | + | 372 | Protein_3250 | PTS sugar transporter subunit IIC | - |
OLR76_RS16640 (3378180) | 3378180..3378737 | + | 558 | Protein_3251 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3364966..3374913 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T262732 WP_000347273.1 NZ_CP110017:3374449-3374913 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |