Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3374112..3374911 | Replicon | chromosome |
| Accession | NZ_CP110016 | ||
| Organism | Escherichia coli strain HE_100 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | OLR74_RS16625 | Protein ID | WP_000347273.1 |
| Coordinates | 3374447..3374911 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | OLR74_RS16620 | Protein ID | WP_001307405.1 |
| Coordinates | 3374112..3374447 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR74_RS16605 (3369897) | 3369897..3370667 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| OLR74_RS16610 (3370683) | 3370683..3372017 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| OLR74_RS16615 (3372392) | 3372392..3373963 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| OLR74_RS16620 (3374112) | 3374112..3374447 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| OLR74_RS16625 (3374447) | 3374447..3374911 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| OLR74_RS16630 (3374966) | 3374966..3375775 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| OLR74_RS16635 (3376024) | 3376024..3377304 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| OLR74_RS16640 (3377327) | 3377327..3377800 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| OLR74_RS16645 (3377811) | 3377811..3378182 | + | 372 | Protein_3252 | PTS sugar transporter subunit IIC | - |
| OLR74_RS16650 (3378178) | 3378178..3378735 | + | 558 | Protein_3253 | amidohydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 3364964..3374911 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T262706 WP_000347273.1 NZ_CP110016:3374447-3374911 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |