Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 605412..606211 | Replicon | chromosome |
| Accession | NZ_CP106996 | ||
| Organism | Escherichia coli strain SY22D8 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | OFB06_RS02955 | Protein ID | WP_000347273.1 |
| Coordinates | 605412..605876 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | OFB06_RS02960 | Protein ID | WP_001307405.1 |
| Coordinates | 605876..606211 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OFB06_RS02930 (601588) | 601588..602145 | - | 558 | Protein_574 | amidohydrolase family protein | - |
| OFB06_RS02935 (602141) | 602141..602512 | - | 372 | Protein_575 | PTS sugar transporter subunit IIC | - |
| OFB06_RS02940 (602523) | 602523..602996 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| OFB06_RS02945 (603019) | 603019..604299 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| OFB06_RS02950 (604548) | 604548..605357 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| OFB06_RS02955 (605412) | 605412..605876 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| OFB06_RS02960 (605876) | 605876..606211 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| OFB06_RS02965 (606360) | 606360..607931 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| OFB06_RS02970 (608306) | 608306..609640 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| OFB06_RS02975 (609656) | 609656..610426 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 605412..617086 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T260162 WP_000347273.1 NZ_CP106996:c605876-605412 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |