Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3501515..3502314 | Replicon | chromosome |
Accession | NZ_CP104788 | ||
Organism | Escherichia coli strain SHP24 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | N6H17_RS17255 | Protein ID | WP_000347273.1 |
Coordinates | 3501850..3502314 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N6H17_RS17250 | Protein ID | WP_001307405.1 |
Coordinates | 3501515..3501850 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H17_RS17235 (3497300) | 3497300..3498070 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
N6H17_RS17240 (3498086) | 3498086..3499420 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
N6H17_RS17245 (3499795) | 3499795..3501366 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
N6H17_RS17250 (3501515) | 3501515..3501850 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N6H17_RS17255 (3501850) | 3501850..3502314 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N6H17_RS17260 (3502369) | 3502369..3503178 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N6H17_RS17265 (3503427) | 3503427..3504707 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N6H17_RS17270 (3504730) | 3504730..3505203 | + | 474 | WP_001422480.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N6H17_RS17275 (3505214) | 3505214..3505993 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N6H17_RS17280 (3505983) | 3505983..3506861 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N6H17_RS17285 (3506879) | 3506879..3507313 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3492367..3502314 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T259173 WP_000347273.1 NZ_CP104788:3501850-3502314 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |