Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 611446..612245 | Replicon | chromosome |
| Accession | NZ_CP104721 | ||
| Organism | Escherichia coli strain ECO3183 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
| Locus tag | N5O92_RS02975 | Protein ID | WP_000347275.1 |
| Coordinates | 611446..611910 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | N5O92_RS02980 | Protein ID | WP_001307405.1 |
| Coordinates | 611910..612245 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O92_RS02945 (606447) | 606447..606881 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| N5O92_RS02950 (606899) | 606899..607777 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N5O92_RS02955 (607767) | 607767..608546 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N5O92_RS02960 (608557) | 608557..609030 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N5O92_RS02965 (609053) | 609053..610333 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N5O92_RS02970 (610582) | 610582..611391 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N5O92_RS02975 (611446) | 611446..611910 | - | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N5O92_RS02980 (611910) | 611910..612245 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N5O92_RS02985 (612394) | 612394..613965 | - | 1572 | WP_001273752.1 | galactarate dehydratase | - |
| N5O92_RS02990 (614340) | 614340..615674 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N5O92_RS02995 (615690) | 615690..616460 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 611446..623120 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T259035 WP_000347275.1 NZ_CP104721:c611910-611446 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A6SPA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |