Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4304444..4305243 | Replicon | chromosome |
| Accession | NZ_CP104509 | ||
| Organism | Escherichia coli strain E2 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | N5O74_RS21790 | Protein ID | WP_000347273.1 |
| Coordinates | 4304779..4305243 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | N5O74_RS21785 | Protein ID | WP_001307405.1 |
| Coordinates | 4304444..4304779 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O74_RS21770 (4300229) | 4300229..4300999 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| N5O74_RS21775 (4301015) | 4301015..4302349 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N5O74_RS21780 (4302724) | 4302724..4304295 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| N5O74_RS21785 (4304444) | 4304444..4304779 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N5O74_RS21790 (4304779) | 4304779..4305243 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N5O74_RS21795 (4305298) | 4305298..4306107 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N5O74_RS21800 (4306356) | 4306356..4307636 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N5O74_RS21805 (4307659) | 4307659..4308132 | + | 474 | WP_134235305.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N5O74_RS21810 (4308143) | 4308143..4308922 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N5O74_RS21815 (4308912) | 4308912..4309790 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N5O74_RS21820 (4309808) | 4309808..4310242 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 4295296..4305243 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T258204 WP_000347273.1 NZ_CP104509:4304779-4305243 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |