Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4058640..4059439 | Replicon | chromosome |
Accession | NZ_CP104114 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51408 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | N1706_RS19535 | Protein ID | WP_000347275.1 |
Coordinates | 4058975..4059439 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N1706_RS19530 | Protein ID | WP_001307405.1 |
Coordinates | 4058640..4058975 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1706_RS19515 (4054425) | 4054425..4055195 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
N1706_RS19520 (4055211) | 4055211..4056545 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
N1706_RS19525 (4056920) | 4056920..4058491 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
N1706_RS19530 (4058640) | 4058640..4058975 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N1706_RS19535 (4058975) | 4058975..4059439 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N1706_RS19540 (4059494) | 4059494..4060303 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N1706_RS19545 (4060552) | 4060552..4061832 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N1706_RS19550 (4061855) | 4061855..4062328 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N1706_RS19555 (4062339) | 4062339..4063118 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N1706_RS19560 (4063108) | 4063108..4063986 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N1706_RS19565 (4064004) | 4064004..4064438 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4049492..4059439 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T257235 WP_000347275.1 NZ_CP104114:4058975-4059439 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |