Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3897884..3898683 | Replicon | chromosome |
| Accession | NZ_CP104112 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-51688 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | N1707_RS19060 | Protein ID | WP_000347251.1 |
| Coordinates | 3898219..3898683 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | N1707_RS19055 | Protein ID | WP_001307405.1 |
| Coordinates | 3897884..3898219 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1707_RS19040 (3893669) | 3893669..3894439 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| N1707_RS19045 (3894455) | 3894455..3895789 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N1707_RS19050 (3896164) | 3896164..3897735 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| N1707_RS19055 (3897884) | 3897884..3898219 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N1707_RS19060 (3898219) | 3898219..3898683 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N1707_RS19065 (3898738) | 3898738..3899547 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N1707_RS19070 (3899796) | 3899796..3901076 | + | 1281 | WP_000681905.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N1707_RS19075 (3901099) | 3901099..3901572 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N1707_RS19080 (3901583) | 3901583..3902362 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N1707_RS19085 (3902352) | 3902352..3903230 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N1707_RS19090 (3903248) | 3903248..3903682 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 3887114..3898683 | 11569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T257215 WP_000347251.1 NZ_CP104112:3898219-3898683 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |