Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2102219..2103018 | Replicon | chromosome |
| Accession | NZ_CP103972 | ||
| Organism | Escherichia coli strain DLI.5a | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
| Locus tag | NZD79_RS10270 | Protein ID | WP_000347275.1 |
| Coordinates | 2102554..2103018 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NZD79_RS10265 | Protein ID | WP_001307405.1 |
| Coordinates | 2102219..2102554 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZD79_RS10250 (2098004) | 2098004..2098774 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NZD79_RS10255 (2098790) | 2098790..2100124 | - | 1335 | WP_259568217.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NZD79_RS10260 (2100499) | 2100499..2102070 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| NZD79_RS10265 (2102219) | 2102219..2102554 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NZD79_RS10270 (2102554) | 2102554..2103018 | + | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NZD79_RS10275 (2103073) | 2103073..2103882 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NZD79_RS10280 (2104131) | 2104131..2105411 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NZD79_RS10285 (2105434) | 2105434..2105907 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NZD79_RS10290 (2105918) | 2105918..2106697 | + | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NZD79_RS10295 (2106743) | 2106743..2107042 | + | 300 | Protein_2019 | amidohydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 2093119..2103018 | 9899 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T256930 WP_000347275.1 NZ_CP103972:2102554-2103018 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A6SPA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |