Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 649956..650755 | Replicon | chromosome |
Accession | NZ_CP103529 | ||
Organism | Escherichia coli strain 5270 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0A6SPA6 |
Locus tag | M5T24_RS03165 | Protein ID | WP_000347275.1 |
Coordinates | 649956..650420 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | M5T24_RS03170 | Protein ID | WP_001307405.1 |
Coordinates | 650420..650755 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T24_RS03135 (644957) | 644957..645391 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
M5T24_RS03140 (645409) | 645409..646287 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
M5T24_RS03145 (646277) | 646277..647056 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
M5T24_RS03150 (647067) | 647067..647540 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
M5T24_RS03155 (647563) | 647563..648843 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
M5T24_RS03160 (649092) | 649092..649901 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
M5T24_RS03165 (649956) | 649956..650420 | - | 465 | WP_000347275.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M5T24_RS03170 (650420) | 650420..650755 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M5T24_RS03175 (650904) | 650904..652475 | - | 1572 | WP_001273752.1 | galactarate dehydratase | - |
M5T24_RS03180 (652850) | 652850..654184 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
M5T24_RS03185 (654200) | 654200..654970 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 649956..661630 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17820.29 Da Isoelectric Point: 9.8492
>T255326 WP_000347275.1 NZ_CP103529:c650420-649956 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKVPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6SPA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |