Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3148106..3148905 | Replicon | chromosome |
Accession | NZ_CP102380 | ||
Organism | Escherichia coli strain BM28 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | NR349_RS15300 | Protein ID | WP_000347273.1 |
Coordinates | 3148441..3148905 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NR349_RS15295 | Protein ID | WP_001307405.1 |
Coordinates | 3148106..3148441 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR349_RS15280 (3143891) | 3143891..3144661 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NR349_RS15285 (3144677) | 3144677..3146011 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NR349_RS15290 (3146386) | 3146386..3147957 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
NR349_RS15295 (3148106) | 3148106..3148441 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NR349_RS15300 (3148441) | 3148441..3148905 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NR349_RS15305 (3148960) | 3148960..3149769 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NR349_RS15310 (3150018) | 3150018..3151298 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NR349_RS15315 (3151321) | 3151321..3151794 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NR349_RS15320 (3151805) | 3151805..3152176 | + | 372 | Protein_2989 | PTS sugar transporter subunit IIC | - |
NR349_RS15325 (3152172) | 3152172..3152729 | + | 558 | Protein_2990 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3138958..3148905 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T253588 WP_000347273.1 NZ_CP102380:3148441-3148905 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |