Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3146770..3147569 | Replicon | chromosome |
Accession | NZ_CP102379 | ||
Organism | Escherichia coli strain BM28 lysU |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | NR350_RS15305 | Protein ID | WP_000347273.1 |
Coordinates | 3147105..3147569 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NR350_RS15300 | Protein ID | WP_001307405.1 |
Coordinates | 3146770..3147105 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR350_RS15285 (3142555) | 3142555..3143325 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NR350_RS15290 (3143341) | 3143341..3144675 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NR350_RS15295 (3145050) | 3145050..3146621 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
NR350_RS15300 (3146770) | 3146770..3147105 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NR350_RS15305 (3147105) | 3147105..3147569 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NR350_RS15310 (3147624) | 3147624..3148433 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NR350_RS15315 (3148682) | 3148682..3149962 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NR350_RS15320 (3149985) | 3149985..3150458 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NR350_RS15325 (3150469) | 3150469..3150840 | + | 372 | Protein_2990 | PTS sugar transporter subunit IIC | - |
NR350_RS15330 (3150836) | 3150836..3151393 | + | 558 | Protein_2991 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3137622..3147569 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T253554 WP_000347273.1 NZ_CP102379:3147105-3147569 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |