Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3287638..3288437 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | NR351_RS16070 | Protein ID | WP_000347273.1 |
Coordinates | 3287973..3288437 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NR351_RS16065 | Protein ID | WP_001307405.1 |
Coordinates | 3287638..3287973 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS16050 (3283423) | 3283423..3284193 | - | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NR351_RS16055 (3284209) | 3284209..3285543 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NR351_RS16060 (3285918) | 3285918..3287489 | + | 1572 | WP_001273753.1 | galactarate dehydratase | - |
NR351_RS16065 (3287638) | 3287638..3287973 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NR351_RS16070 (3287973) | 3287973..3288437 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NR351_RS16075 (3288492) | 3288492..3289301 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NR351_RS16080 (3289550) | 3289550..3290830 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NR351_RS16085 (3290853) | 3290853..3291326 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NR351_RS16090 (3291337) | 3291337..3291708 | + | 372 | Protein_3142 | PTS sugar transporter subunit IIC | - |
NR351_RS16095 (3291704) | 3291704..3292261 | + | 558 | Protein_3143 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3278490..3288437 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T253519 WP_000347273.1 NZ_CP102378:3287973-3288437 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |