Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 1231063..1231862 | Replicon | chromosome |
Accession | NZ_CP097884 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | NAG72_RS05890 | Protein ID | WP_000347273.1 |
Coordinates | 1231063..1231527 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NAG72_RS05895 | Protein ID | WP_001307405.1 |
Coordinates | 1231527..1231862 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG72_RS05865 (1227239) | 1227239..1227796 | - | 558 | Protein_1128 | amidohydrolase family protein | - |
NAG72_RS05870 (1227792) | 1227792..1228163 | - | 372 | Protein_1129 | PTS sugar transporter subunit IIC | - |
NAG72_RS05875 (1228174) | 1228174..1228647 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NAG72_RS05880 (1228670) | 1228670..1229950 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NAG72_RS05885 (1230199) | 1230199..1231008 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NAG72_RS05890 (1231063) | 1231063..1231527 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NAG72_RS05895 (1231527) | 1231527..1231862 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NAG72_RS05900 (1232011) | 1232011..1233582 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
NAG72_RS05905 (1233957) | 1233957..1235291 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NAG72_RS05910 (1235307) | 1235307..1236077 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1231063..1242737 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T246487 WP_000347273.1 NZ_CP097884:c1231527-1231063 [Escherichia coli str. K-12 substr. MG1655]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12358.94 Da Isoelectric Point: 4.8616
>AT246487 WP_001307405.1 NZ_CP097884:c1231862-1231527 [Escherichia coli str. K-12 substr. MG1655]
MPANARSHAVLTTESKVTIRGQTTIPAPVREALKLKPGQDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFNIQQGKKLVAGMDVNIDDEIGDDE
MPANARSHAVLTTESKVTIRGQTTIPAPVREALKLKPGQDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFNIQQGKKLVAGMDVNIDDEIGDDE
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |