TAfinder detailed results
Overview
| Job ID | wrVbGpMxFf | ||
| Sequence name | NZ_CP026085.1 Escherichia coli strain DH5alpha chromosome, complete genome | ||
| Predicted type | I | ||
Orphan Toxin (Protein)
| Predicted family | hokX (T10211) | Predicted domain | - |
| Locus tag | orf3242 | Length | 50 a.a. |
| Coordinates | 3422815..3422967 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| orf3234 | 3419155..3421395 | + | 2241 | ORF3234 | Predicted ORF by PRODIGAL Version 1.20 | - |
| orf3235 | 3421561..3422190 | + | 630 | ORF3235 | Predicted ORF by PRODIGAL Version 1.20 | - |
| orf3236 | 3422312..3422464 | - | 153 | ORF3236 | Predicted ORF by PRODIGAL Version 1.20 | - |
| orf3237 | 3422815..3422967 | - | 153 | ORF3237 | Predicted ORF by PRODIGAL Version 1.20 | Toxin |
| orf3238 | 3423409..3424527 | + | 1119 | ORF3238 | Predicted ORF by PRODIGAL Version 1.20 | - |
| orf3239 | 3424593..3424841 | + | 249 | ORF3239 | Predicted ORF by PRODIGAL Version 1.20 | - |
| orf3240 | 3424906..3425274 | + | 369 | ORF3240 | Predicted ORF by PRODIGAL Version 1.20 | - |
| orf3241 | 3425368..3426021 | + | 654 | ORF3241 | Predicted ORF by PRODIGAL Version 1.20 | - |
| orf3242 | 3426129..3427376 | + | 1248 | ORF3242 | Predicted ORF by PRODIGAL Version 1.20 | - |
Domains
The domains were predicted by HMMER and were sorted by score.
Orphan Toxin
No domain identified.
Sequences
Orphan Toxin
Download Length: Molecular weight: 5591.80 Da Isoelectric Point: 7.7891
>ORF3237 Orphan_TA_77 Toxin
MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKVVLAYEPKK
MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKVVLAYEPKK
Download Length: 153 bp
>ORF3237 Orphan_TA_77 Toxin
CTACTTCTTCGGTTCGTAAGCGAGAACAACCTTAAACTCAATATTACGTTCCTTTACGGT
GAACTCACACAGCGAATCCCCGACCAGAAGCGTAAATCCCAGCACCGTTAAACACAGCAC
TATGACTGCCGCAAGGGCATATTTCGTCAGCAT
CTACTTCTTCGGTTCGTAAGCGAGAACAACCTTAAACTCAATATTACGTTCCTTTACGGT
GAACTCACACAGCGAATCCCCGACCAGAAGCGTAAATCCCAGCACCGTTAAACACAGCAC
TATGACTGCCGCAAGGGCATATTTCGTCAGCAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10211 | E.coli NADPH-sulfite reductase flavoprotein component (cysJ) NADPH-sulfite reductase hemoprotein component (cysI) and 3' |
54 |
100 |
0.54 |
| T6369 | Escherichia coli K-12 |
42.857 |
100 |
0.42 |
| T10208 | Escherichia coli C |
44.444 |
90 |
0.4 |
| T10210 | Hafnia alvei |
42 |
96.154 |
0.42 |
| T6370 | Escherichia coli |
40.909 |
88 |
0.36 |
| T6324 | Escherichia coli |
41.463 |
78.846 |
0.34 |
| T6363 | uncultured bacterium |
41.463 |
78.846 |
0.34 |
| T10039 | Escherichia coli O157:H7 str. Sakai |
38.298 |
92.157 |
0.36 |
| T10209 | Escherichia coli strain ECOR24 |
32.609 |
92 |
0.3 |
| T10124 | Erwinia amylovora ATCC 49946 |
41.935 |
96.875 |
0.26 |