TAfinder detailed results

Overview

Job ID wrVbGpMxFf
Sequence name NZ_CP026085.1 Escherichia coli strain DH5alpha chromosome, complete genome
Predicted type I

Orphan Toxin (Protein)


Predicted family hokX (T10211) Predicted domain -
Locus tag orf3242 Length 50 a.a.
Coordinates 3422815..3422967 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
orf3234 3419155..3421395 + 2241 ORF3234 Predicted ORF by PRODIGAL Version 1.20 -
orf3235 3421561..3422190 + 630 ORF3235 Predicted ORF by PRODIGAL Version 1.20 -
orf3236 3422312..3422464 - 153 ORF3236 Predicted ORF by PRODIGAL Version 1.20 -
orf3237 3422815..3422967 - 153 ORF3237 Predicted ORF by PRODIGAL Version 1.20 Toxin
orf3238 3423409..3424527 + 1119 ORF3238 Predicted ORF by PRODIGAL Version 1.20 -
orf3239 3424593..3424841 + 249 ORF3239 Predicted ORF by PRODIGAL Version 1.20 -
orf3240 3424906..3425274 + 369 ORF3240 Predicted ORF by PRODIGAL Version 1.20 -
orf3241 3425368..3426021 + 654 ORF3241 Predicted ORF by PRODIGAL Version 1.20 -
orf3242 3426129..3427376 + 1248 ORF3242 Predicted ORF by PRODIGAL Version 1.20 -

Domains

The domains were predicted by HMMER and were sorted by score.

Orphan Toxin


No domain identified.



Sequences

Orphan Toxin        


Download         Length:         Molecular weight: 5591.80 Da        Isoelectric Point: 7.7891

>ORF3237 Orphan_TA_77 Toxin
MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKVVLAYEPKK

Download         Length: 153 bp

>ORF3237 Orphan_TA_77 Toxin
CTACTTCTTCGGTTCGTAAGCGAGAACAACCTTAAACTCAATATTACGTTCCTTTACGGT
GAACTCACACAGCGAATCCCCGACCAGAAGCGTAAATCCCAGCACCGTTAAACACAGCAC
TATGACTGCCGCAAGGGCATATTTCGTCAGCAT

Similar Proteins

Only experimentally validated proteins are listed.