Detailed information of effector


Summary

Effector ID EFF01279 experimental
Effector type Tle
Cognate immunity protein IMU00044 experimental; IMU00045 experimental; IMU00046 experimental
Related T6SS (Type) T6SS00005 experimental (Type i4a)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (746 a.a.); Nucleotide sequence (2238 bp)
Description PldB; phospholipase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA5089 (PldB)
Coordinates (Strand) 5727239..5729476 (-)
NCBI ID 15600282
RefSeq NC_002516
Uniprot ID Q9HU94_PSEAE
KEGG ID pae:PA5089
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PLDc_2 PF13091.8 8.5e-05 640..690

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-745 MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWVGSGVASGSAVDNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSFDPRGAAHARTRIAELEAENAEIQRTLDSSGAQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIHLLRADGIDDLGIGQLLVLTQFASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGFGPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQPQDDERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVTNTPDSSDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEEKGVTPEVEQRLGDLGAQEIPGLAKNTGEDDKPYQLVEVPGLKVVVATLATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANINVRSMHGDSELGVAQPNPDLARAMREELWELHAQKVATTTEKNFKLWNQKMDANWRQQRKDEPLVANLLRFWDVVTPYSPGLTVD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9930 - -



  Protein sequence: 746 a.a.    .

>EFF01279 NC_002516:c5729476-5727239 [Pseudomonas aeruginosa PAO1]
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITWGFDPAMRFKR
PDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWVGSGVASGSAVDNEVLRLEQRRQHNLNLIAR
QQEALERSERLHREGRLPSFDPRGAAHARTRIAELEAENAEIQRTLDSSGAQGYGGKRGSGGTRQDPWGQIFTRDWFKAV
RGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIHLLRADGIDDLGIGQLLVLTQFASHHQKMVLVDYGSPQAIG
FVMGHNMHRNYWDTSAHLFDDRAAGRDPGFGPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALP
LPKIATPASNSVAQICRTQPQDDERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVT
NTPDSSDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEEKGVT
PEVEQRLGDLGAQEIPGLAKNTGEDDKPYQLVEVPGLKVVVATLATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIY
VHSKLLLVDDLYTLLSSANINVRSMHGDSELGVAQPNPDLARAMREELWELHAQKVATTTEKNFKLWNQKMDANWRQQRK
DEPLVANLLRFWDVVTPYSPGLTVD*

  Nucleotide sequence: 2238 bp    .

>EFF01279 NC_002516:c5729476-5727239 [Pseudomonas aeruginosa PAO1]
ATGAGCGACCTGTACAAACCGCAAACCCTCAAGCTGTACGCGCAACAGGCCGGCAGCGTCCGGCTGACCCTCGACTGGTT
CGCCAACAAGGCCTTCTACCCACCGCGCGCGGGTGTGCACATCAAGCCGCTGATCAATGGCCAGGCGGCCTTCGACGCGG
TGCATGCGGCGATGGAAGCGGCCCGGCACAGCATCGACATCATCACCTGGGGCTTCGACCCGGCCATGCGCTTCAAGCGC
CCCGACGGACCGCGAATCGGCGAATTGCTGCAGACGAAGGGCCGCGAAGGAGTGCAGGCGCGGGTGCTGGTCTGGAGCAA
CCAGCTCGCCAGGCTCAAGGAAAACACCATCCCCGGGGCCGGCGTCGGCGGTTCCGGCGGCACCTGGGTGGGCTCGGGCG
TCGCCAGCGGCAGTGCGGTGGACAACGAGGTGCTGCGGCTGGAGCAGCGGCGCCAGCATAACCTCAACCTCATCGCGCGG
CAGCAGGAAGCCCTGGAGCGCTCGGAACGGCTGCACCGCGAAGGCAGGCTGCCGAGCTTCGACCCGCGGGGCGCCGCCCA
CGCGCGGACGCGCATCGCCGAGCTGGAGGCGGAGAACGCCGAGATCCAGCGCACTCTCGACAGCAGCGGGGCCCAGGGCT
ACGGCGGCAAGCGCGGTTCCGGCGGCACCCGCCAGGATCCCTGGGGGCAGATATTCACCCGCGACTGGTTCAAGGCGGTA
CGCGGCGGTGGGTTGCAGAACGTCGAGTTCCGTACCCGCGACTTCGAGCAGACGGCCAGGCCGGTGATGAACGGCGAGCA
GGTGCGCCTCGTCAACGGGCGGCTGCAAAGCCTGATCCACCTGCTGCGCGCCGATGGCATCGACGACCTGGGCATCGGCC
AGTTGCTGGTACTCACCCAGTTCGCCAGCCATCACCAGAAGATGGTCCTGGTCGACTATGGCAGCCCGCAGGCCATCGGC
TTCGTCATGGGTCACAACATGCACCGCAACTACTGGGACACCAGCGCCCACCTGTTCGACGACCGCGCCGCCGGTCGCGA
TCCCGGGTTCGGGCCCTGGCAGGATATCTCCATGCAGGTCCAGGGCCCGGTGCTGGCCGACCTCAGCCGCAACTTCAGCG
AGGCCTGGGATCTCGAGACGCCGTGGTACAAGCGCTGGTTCTCGACGCCATCGCTGACCGCCGAGCGCGACGCCTTGCCG
CTGCCGAAGATCGCCACGCCCGCCAGCAACAGCGTCGCGCAGATTTGCCGAACCCAGCCGCAGGACGACGAGCGCTCGAT
CCTGGAGCACTATCTCAAGGCCCTGGGCAATGCCACCGACTACGTCTACATGGAAAACCAGTACTTCCGTTATGCCGGCT
TCGCCGAGCGCCTGCGGAAGACTGCGCAGGTGCGCAAGGCCCGGGGCGTGCCCGGCGACCTGTACCTGTTCGTCGTGACC
AACACCCCCGACTCCAGCGACGCCTCGAAGACCACCTACGACATGATGAAAGGCCTGGGCCAGGAGCAACTGATGCCGCA
GGTACAGCGCGACCTGGCGCATGACTTGCGGGAAAAGCGGGAGCAGTTGAAGCAGGTCAGGGAAAACCTACATCCCGATC
CCTATGTCCGGCGCGGCCAGGAAAACAACATCGAACGGCTGGAGCGCAAGATCGAGGCGCTCGAAGAGAAAGGCGTGACG
CCGGAAGTCGAGCAACGCCTCGGCGATCTCGGCGCGCAGGAGATTCCCGGACTGGCGAAGAACACCGGCGAGGACGACAA
GCCCTATCAACTCGTCGAAGTACCCGGCCTCAAGGTGGTCGTCGCCACCCTGGCCACCAGCGACCCTGCCCCCGGCAGCC
CGCCGCCAGCGCGCCTGTCCGCCGAAGCCGAGGCCGCCCTCGGGGCGCCGCCGCTGAAGGCGCGCTACAAGCACATCTAC
GTGCACTCCAAGCTGCTGCTGGTGGATGACCTCTATACCCTGCTCAGCTCGGCCAATATCAATGTCCGCAGCATGCATGG
CGACAGCGAGTTGGGGGTTGCCCAGCCCAATCCGGATTTGGCGAGGGCGATGCGGGAGGAGTTGTGGGAGCTACATGCCC
AGAAAGTGGCTACGACAACCGAAAAAAACTTCAAACTCTGGAATCAGAAAATGGATGCGAATTGGAGACAGCAACGTAAA
GACGAGCCTTTGGTAGCTAACTTGCTTCGCTTCTGGGATGTCGTGACACCTTATAGCCCCGGTCTCACGGTGGACTGA