Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   EL076_RS09120 Genome accession   NZ_LR134275
Coordinates   1803972..1804202 (-) Length   76 a.a.
NCBI ID   WP_003095891.1    Uniprot ID   A0ABP2KL85
Organism   Streptococcus vestibularis strain NCTC12167     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1798972..1809202
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL076_RS09085 (NCTC12167_01792) - 1799358..1800020 (-) 663 WP_003095899.1 CPBP family intramembrane glutamic endopeptidase -
  EL076_RS10515 - 1800120..1800590 (-) 471 WP_082901122.1 CAAX protease -
  EL076_RS09095 (NCTC12167_01794) - 1800577..1800774 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  EL076_RS09100 (NCTC12167_01795) - 1801002..1802195 (-) 1194 WP_064520007.1 acetate kinase -
  EL076_RS09105 (NCTC12167_01796) comGH 1802252..1803208 (-) 957 WP_126430075.1 class I SAM-dependent methyltransferase Machinery gene
  EL076_RS09110 (NCTC12167_01797) comGG 1803253..1803570 (-) 318 WP_003092009.1 competence type IV pilus minor pilin ComGG Machinery gene
  EL076_RS09115 (NCTC12167_01798) comGF 1803548..1803985 (-) 438 WP_003091908.1 competence type IV pilus minor pilin ComGF Machinery gene
  EL076_RS09120 (NCTC12167_01799) comGE 1803972..1804202 (-) 231 WP_003095891.1 competence type IV pilus minor pilin ComGE Machinery gene
  EL076_RS09125 (NCTC12167_01800) comGD 1804234..1804662 (-) 429 WP_253665936.1 competence type IV pilus minor pilin ComGD Machinery gene
  EL076_RS09130 (NCTC12167_01801) comGC 1804622..1804948 (-) 327 WP_002885815.1 competence type IV pilus major pilin ComGC Machinery gene
  EL076_RS09135 (NCTC12167_01802) comGB 1804945..1806045 (-) 1101 WP_126430077.1 competence type IV pilus assembly protein ComGB Machinery gene
  EL076_RS09140 (NCTC12167_01803) comGA/cglA/cilD 1805927..1806868 (-) 942 WP_126430079.1 competence type IV pilus ATPase ComGA Machinery gene
  EL076_RS09145 (NCTC12167_01804) tnpA 1807052..1807516 (-) 465 WP_002883780.1 IS200/IS605 family transposase -
  EL076_RS09150 (NCTC12167_01805) - 1807715..1808077 (-) 363 WP_126430081.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8417.84 Da        Isoelectric Point: 10.6777

>NTDB_id=999747 EL076_RS09120 WP_003095891.1 1803972..1804202(-) (comGE) [Streptococcus vestibularis strain NCTC12167]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGITVYESGKEITHVSK

Nucleotide


Download         Length: 231 bp        

>NTDB_id=999747 EL076_RS09120 WP_003095891.1 1803972..1804202(-) (comGE) [Streptococcus vestibularis strain NCTC12167]
ATGGCTGTTTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCTACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGTATCACAGTGA
CAGTAAAACGTAGCAAGCAAGGCATCACAGTTTATGAATCAGGAAAGGAAATTACTCATGTCTCTAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

36.842

100

0.368

  comGE Streptococcus mutans UA159

36.842

100

0.368


Multiple sequence alignment