Detailed information NTG0996288

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLNCDO184_RS11610
• Genome accession: NZ_CP155124
• Coordinates: 2245186..2245569 (-)
• Length: 127 a.a.
• NCBI ID: WP_010906318.1
• Uniprot ID: A0A3N6KXZ7
• Organism: Lactococcus lactis subsp. lactis strain NCDO184
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2240186..2250569

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLNCDO184_RS11570 (LLNCDO184_11560)	-	2240722..2241531 (-)	810	WP_010906310.1	metal ABC transporter permease	-
LLNCDO184_RS11575 (LLNCDO184_11565)	-	2241524..2242261 (-)	738	WP_010906311.1	metal ABC transporter ATP-binding protein	-
LLNCDO184_RS11580 (LLNCDO184_11570)	-	2242438..2243280 (-)	843	WP_063283655.1	metal ABC transporter substrate-binding protein	-
LLNCDO184_RS11585 (LLNCDO184_11575)	-	2243277..2243714 (-)	438	WP_010906313.1	zinc-dependent MarR family transcriptional regulator	-
LLNCDO184_RS11590 (LLNCDO184_11580)	comGG	2243795..2244079 (-)	285	WP_010906314.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLNCDO184_RS11595 (LLNCDO184_11585)	comGF	2244118..2244564 (-)	447	WP_031296844.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLNCDO184_RS11600 (LLNCDO184_11590)	comGE	2244527..2244823 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLNCDO184_RS11605 (LLNCDO184_11595)	comGD	2244795..2245193 (-)	399	WP_021214886.1	competence type IV pilus minor pilin ComGD	Machinery gene
LLNCDO184_RS11610 (LLNCDO184_11600)	comGC	2245186..2245569 (-)	384	WP_010906318.1	competence type IV pilus major pilin ComGC	Machinery gene
LLNCDO184_RS11615 (LLNCDO184_11605)	comGB	2245583..2246656 (-)	1074	WP_010906319.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLNCDO184_RS11620 (LLNCDO184_11610)	comGA	2246550..2247488 (-)	939	WP_031561106.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

• Length: 127 a.a.
• Molecular weight: 14797.39 Da
• Isoelectric Point: 8.4538

>NTDB_id=996288 LLNCDO184_RS11610 WP_010906318.1 2245186..2245569(-) (comGC) [Lactococcus lactis subsp. lactis strain NCDO184]
MERTKKFILKKIQKIFLFVKICEKKCRQKELKAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQA
QLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

• Length: 384 bp

>NTDB_id=996288 LLNCDO184_RS11610 WP_010906318.1 2245186..2245569(-) (comGC) [Lactococcus lactis subsp. lactis strain NCDO184]
ATGGAAAGAACAAAGAAGTTTATTTTAAAAAAAATACAAAAAATATTTTTATTCGTTAAAATTTGTGAAAAAAAATGCCG
TCAGAAAGAGCTAAAAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTG
TTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTCAAAGTAGTAGAAAGTCAAGCT
CAACTTTATGAATTAGATCATGATGATGAGAAGCCGAGTCTGTCAGAATTGCTCAGTGCAGGGATGATTACTCAAAAACA
AATTTCTGCTTACGATAATTACTATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (32-52)

3D structure

• AlphaFold DB: A0A3N6KXZ7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	81.034	91.339	0.74
comGC/cglC	Streptococcus mitis SK321	56.436	79.528	0.449
comYC	Streptococcus mutans UA159	55.446	79.528	0.441
comYC	Streptococcus mutans UA140	55.446	79.528	0.441
comYC	Streptococcus gordonii str. Challis substr. CH1	56.566	77.953	0.441
comGC/cglC	Streptococcus pneumoniae TIGR4	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae Rx1	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae D39	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae R6	54.455	79.528	0.433
comGC/cglC	Streptococcus mitis NCTC 12261	58.427	70.079	0.409
comYC	Streptococcus suis isolate S10	56.818	69.291	0.394